Lineage for d1ji1b1 (1ji1 B:1-122)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (8 PDB entries)
  8. Domain d1ji1b1: 1ji1 B:1-122 [71669]
    Other proteins in same PDB: d1ji1a2, d1ji1a3, d1ji1b2, d1ji1b3
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1ji1b1

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (B:) alpha-amylase I

SCOPe Domain Sequences for d1ji1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1b1 b.1.18.2 (B:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOPe Domain Coordinates for d1ji1b1 are not available.

Timeline for d1ji1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ji1b2, d1ji1b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1ji1a1, d1ji1a2, d1ji1a3