Lineage for d1ji1a3 (1ji1 A:123-554)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236227Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 236424Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 236428Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75061] (1 PDB entry)
  8. 236429Domain d1ji1a3: 1ji1 A:123-554 [71668]
    Other proteins in same PDB: d1ji1a1, d1ji1a2, d1ji1b1, d1ji1b2

Details for d1ji1a3

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1

SCOP Domain Sequences for d1ji1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOP Domain Coordinates for d1ji1a3:

Click to download the PDB-style file with coordinates for d1ji1a3.
(The format of our PDB-style files is described here.)

Timeline for d1ji1a3: