Lineage for d1ji1a3 (1ji1 A:123-554)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173367Protein Maltogenic amylase, central domain [51465] (4 species)
  7. 173371Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75061] (1 PDB entry)
  8. 173372Domain d1ji1a3: 1ji1 A:123-554 [71668]
    Other proteins in same PDB: d1ji1a1, d1ji1a2, d1ji1b1, d1ji1b2

Details for d1ji1a3

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (A:)

SCOP Domain Sequences for d1ji1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOP Domain Coordinates for d1ji1a3:

Click to download the PDB-style file with coordinates for d1ji1a3.
(The format of our PDB-style files is described here.)

Timeline for d1ji1a3: