Lineage for d1ji1a2 (1ji1 A:555-637)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302223Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 302224Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) (S)
  5. 302225Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 302409Protein Maltogenic amylase [51031] (4 species)
  7. 302413Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (3 PDB entries)
  8. 302414Domain d1ji1a2: 1ji1 A:555-637 [71667]
    Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3

Details for d1ji1a2

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1

SCOP Domain Sequences for d1ji1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOP Domain Coordinates for d1ji1a2:

Click to download the PDB-style file with coordinates for d1ji1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ji1a2: