Lineage for d1ji0a_ (1ji0 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180114Family c.37.1.12: ABC transporter ATPase domain-like [52686] (11 proteins)
  6. 180122Protein Branched chain amino acid ABC transporter [75207] (1 species)
  7. 180123Species Thermotoga maritima, TM1139 [TaxId:2336] [75208] (1 PDB entry)
  8. 180124Domain d1ji0a_: 1ji0 A: [71665]

Details for d1ji0a_

PDB Entry: 1ji0 (more details), 2 Å

PDB Description: crystal structure analysis of the abc transporter from thermotoga maritima

SCOP Domain Sequences for d1ji0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji0a_ c.37.1.12 (A:) Branched chain amino acid ABC transporter {Thermotoga maritima, TM1139}
mvsdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqk
gkiifngqditnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdle
wifslfprlkerlkqlggtlsggeqqmlaigralmsrpkllmmdepslglapilvsevfe
viqkinqegttillveqnalgalkvahygyvletgqivlegkaselldnemvrkaylgva

SCOP Domain Coordinates for d1ji0a_:

Click to download the PDB-style file with coordinates for d1ji0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ji0a_: