Lineage for d1jhwa3 (1jhw A:245-346)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870460Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870461Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 870462Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 870554Protein Macrophage capping protein Cap G [75511] (1 species)
  7. 870555Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)
  8. 870561Domain d1jhwa3: 1jhw A:245-346 [71664]
    complexed with eu3; mutant

Details for d1jhwa3

PDB Entry: 1jhw (more details), 2.8 Å

PDB Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G
PDB Compounds: (A:) Macrophage capping protein

SCOP Domain Sequences for d1jhwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhwa3 d.109.1.1 (A:245-346) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]}
aqaaalykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrkaneke
rqaalqvaegfisrmqyapntqveilpqgrespifkqffkdw

SCOP Domain Coordinates for d1jhwa3:

Click to download the PDB-style file with coordinates for d1jhwa3.
(The format of our PDB-style files is described here.)

Timeline for d1jhwa3: