Lineage for d1jhwa3 (1jhw A:245-346)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509538Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 509539Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 509589Protein Macrophage capping protein Cap G [75511] (1 species)
  7. 509590Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)
  8. 509596Domain d1jhwa3: 1jhw A:245-346 [71664]

Details for d1jhwa3

PDB Entry: 1jhw (more details), 2.8 Å

PDB Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G

SCOP Domain Sequences for d1jhwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhwa3 d.109.1.1 (A:245-346) Macrophage capping protein Cap G {Human (Homo sapiens)}
aqaaalykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrkaneke
rqaalqvaegfisrmqyapntqveilpqgrespifkqffkdw

SCOP Domain Coordinates for d1jhwa3:

Click to download the PDB-style file with coordinates for d1jhwa3.
(The format of our PDB-style files is described here.)

Timeline for d1jhwa3: