Lineage for d1jhwa2 (1jhw A:125-234)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210163Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2210277Protein Macrophage capping protein Cap G [75511] (1 species)
  7. 2210278Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)
  8. 2210283Domain d1jhwa2: 1jhw A:125-234 [71663]
    complexed with eu3; mutant

Details for d1jhwa2

PDB Entry: 1jhw (more details), 2.8 Å

PDB Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G
PDB Compounds: (A:) Macrophage capping protein

SCOPe Domain Sequences for d1jhwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhwa2 d.109.1.1 (A:125-234) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]}
fkhvvpnevvvqrlyqvkgaknirateralnwdsfntgdcfildlgqnifawcggksnil
ernkardlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnp

SCOPe Domain Coordinates for d1jhwa2:

Click to download the PDB-style file with coordinates for d1jhwa2.
(The format of our PDB-style files is described here.)

Timeline for d1jhwa2: