Lineage for d1jhwa2 (1jhw A:125-234)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333164Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 333165Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 333166Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 333202Protein Macrophage capping protein Cap G [75511] (1 species)
  7. 333203Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)
  8. 333208Domain d1jhwa2: 1jhw A:125-234 [71663]

Details for d1jhwa2

PDB Entry: 1jhw (more details), 2.8 Å

PDB Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G

SCOP Domain Sequences for d1jhwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhwa2 d.109.1.1 (A:125-234) Macrophage capping protein Cap G {Human (Homo sapiens)}
fkhvvpnevvvqrlyqvkgaknirateralnwdsfntgdcfildlgqnifawcggksnil
ernkardlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnp

SCOP Domain Coordinates for d1jhwa2:

Click to download the PDB-style file with coordinates for d1jhwa2.
(The format of our PDB-style files is described here.)

Timeline for d1jhwa2: