SCOP 1.67: Domain d1jfna_: 1jfn A:

Lineage for d1jfna_ (1jfn A:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Apolipoprotein A [57455] (3 species)

7. Species Human (Homo sapiens), IV-6 variant [TaxId:9606] [75673] (1 PDB entry)

8. Domain d1jfna_: 1jfn A: [71660]

Details for d1jfna_

PDB Entry: 1jfn

PDB Description: solution structure of human apolipoprotein(a) kringle iv type 6

SCOP Domain Sequences for d1jfna_:

Sequence; same for both SEQRES and ATOM records:

>d1jfna_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-6 variant}
arihhhhhhiegrapteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrt
teyypnggltrnycrnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq

Timeline for d1jfna_:

• d1jfna_ first appeared in SCOP 1.61
  
• d1jfna_ appears in SCOP 1.65
  
• d1jfna_ appears in SCOP 1.69
  
• d1jfna_ appears in the current release, SCOPe 2.08, called d1jfna1