Lineage for d1jfna1 (1jfn A:14-119)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033270Protein Apolipoprotein A [57455] (3 species)
  7. 3033275Species Human (Homo sapiens), IV-6 variant [TaxId:9606] [75673] (1 PDB entry)
  8. 3033276Domain d1jfna1: 1jfn A:14-119 [71660]
    Other proteins in same PDB: d1jfna2

Details for d1jfna1

PDB Entry: 1jfn (more details)

PDB Description: solution structure of human apolipoprotein(a) kringle iv type 6
PDB Compounds: (A:) apolipoprotein a, kiv-t6

SCOPe Domain Sequences for d1jfna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfna1 g.14.1.1 (A:14-119) Apolipoprotein A {Human (Homo sapiens), IV-6 variant [TaxId: 9606]}
apteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrny
crnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq

SCOPe Domain Coordinates for d1jfna1:

Click to download the PDB-style file with coordinates for d1jfna1.
(The format of our PDB-style files is described here.)

Timeline for d1jfna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jfna2