Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) |
Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins) C-terminal extension is added to the N-terminal domain |
Protein Aspartate racemase [75310] (1 species) |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [159783] (3 PDB entries) |
Domain d1jfla1: 1jfl A:1-115 [71656] |
PDB Entry: 1jfl (more details), 1.9 Å
SCOPe Domain Sequences for d1jfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]} mktigilggmgplataelfrriviktpakrdqehpkviifnnpqipdrtayilgkgedpr pqliwtakrleecgadfiimpcntahafvedirkaikipiismieetakkvkelg
Timeline for d1jfla1: