SCOP 1.71: Domain d1jf6b2: 1jf6 B:503-585

Lineage for d1jf6b2 (1jf6 B:503-585)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)

8. Domain d1jf6b2: 1jf6 B:503-585 [71654]
   Other proteins in same PDB: d1jf6a1, d1jf6a3, d1jf6b1, d1jf6b3
   complexed with ca; mutant

Details for d1jf6b2

PDB Entry: 1jf6, 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y

SCOP Domain Sequences for d1jf6b2:

Sequence; same for both SEQRES and ATOM records:

>d1jf6b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1jf6b2:

• d1jf6b2 first appeared in SCOP 1.61
  
• d1jf6b2 appears in SCOP 1.69
  
• d1jf6b2 appears in SCOP 1.73
  
• d1jf6b2 appears in the current release, SCOPe 2.08