![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries) |
![]() | Domain d1jf6b2: 1jf6 B:503-585 [71654] Other proteins in same PDB: d1jf6a1, d1jf6a3, d1jf6b1, d1jf6b3 complexed with ca; mutant |
PDB Entry: 1jf6 (more details), 3.2 Å
SCOPe Domain Sequences for d1jf6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf6b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1jf6b2: