SCOP 1.61: Domain d1jf6a1: 1jf6 A:1-120

Lineage for d1jf6a1 (1jf6 A:1-120)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)

8. Domain d1jf6a1: 1jf6 A:1-120 [71650]
   Other proteins in same PDB: d1jf6a2, d1jf6a3, d1jf6b2, d1jf6b3

Details for d1jf6a1

PDB Entry: 1jf6, 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y

SCOP Domain Sequences for d1jf6a1:

Sequence; same for both SEQRES and ATOM records:

>d1jf6a1 b.1.1.5 (A:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1jf6a1:

• d1jf6a1 is new in SCOP 1.61
  
• d1jf6a1 appears in SCOP 1.63
  
• d1jf6a1 appears in the current release, SCOPe 2.08