Lineage for d1jf6a1 (1jf6 A:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160787Protein Maltogenic amylase, N-terminal domain [49221] (4 species)
  7. 160794Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)
  8. 160803Domain d1jf6a1: 1jf6 A:1-120 [71650]
    Other proteins in same PDB: d1jf6a2, d1jf6a3, d1jf6b2, d1jf6b3

Details for d1jf6a1

PDB Entry: 1jf6 (more details), 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y

SCOP Domain Sequences for d1jf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf6a1 b.1.1.5 (A:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1jf6a1:

Click to download the PDB-style file with coordinates for d1jf6a1.
(The format of our PDB-style files is described here.)

Timeline for d1jf6a1: