SCOPe 2.06: Domain d1jf5b2: 1jf5 B:503-585

Lineage for d1jf5b2 (1jf5 B:503-585)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1jf5b2: 1jf5 B:503-585 [71648]
   Other proteins in same PDB: d1jf5a1, d1jf5a3, d1jf5b1, d1jf5b3
   complexed with ca; mutant

Details for d1jf5b2

PDB Entry: 1jf5, 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2 mutant f286a

PDB Compounds: (B:) alpha amylase II

SCOPe Domain Sequences for d1jf5b2:

Sequence; same for both SEQRES and ATOM records:

>d1jf5b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1jf5b2:

• d1jf5b2 first appeared in SCOP 1.61
  
• d1jf5b2 appears in SCOPe 2.05
  
• d1jf5b2 appears in SCOPe 2.07
  
• d1jf5b2 appears in the current release, SCOPe 2.08