Lineage for d1jf5b2 (1jf5 B:503-585)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233630Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 233631Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 233632Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 233804Protein Maltogenic amylase [51031] (4 species)
  7. 233811Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)
  8. 233823Domain d1jf5b2: 1jf5 B:503-585 [71648]
    Other proteins in same PDB: d1jf5a1, d1jf5a3, d1jf5b1, d1jf5b3
    complexed with ca; mutant

Details for d1jf5b2

PDB Entry: 1jf5 (more details), 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2 mutant f286a

SCOP Domain Sequences for d1jf5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf5b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1jf5b2:

Click to download the PDB-style file with coordinates for d1jf5b2.
(The format of our PDB-style files is described here.)

Timeline for d1jf5b2: