SCOP 1.61: Domain d1jf5b1: 1jf5 B:1-120

Lineage for d1jf5b1 (1jf5 B:1-120)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)

8. Domain d1jf5b1: 1jf5 B:1-120 [71647]
   Other proteins in same PDB: d1jf5a2, d1jf5a3, d1jf5b2, d1jf5b3

Details for d1jf5b1

PDB Entry: 1jf5, 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2 mutant f286a

SCOP Domain Sequences for d1jf5b1:

Sequence; same for both SEQRES and ATOM records:

>d1jf5b1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1jf5b1:

• d1jf5b1 is new in SCOP 1.61
  
• d1jf5b1 appears in SCOP 1.63
  
• d1jf5b1 appears in the current release, SCOPe 2.08