![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Glycera globin [46467] (1 species) |
![]() | Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries) |
![]() | Domain d1jf4a_: 1jf4 A: [71643] component IV complexed with hem |
PDB Entry: 1jf4 (more details), 1.4 Å
SCOP Domain Sequences for d1jf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf4a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata)} glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg kmnaaakdawaaayadisgalisglqs
Timeline for d1jf4a_: