Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Glycera globin [46467] (1 species) |
Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries) |
Domain d1jf3a_: 1jf3 A: [71642] component III complexed with hem |
PDB Entry: 1jf3 (more details), 1.4 Å
SCOPe Domain Sequences for d1jf3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf3a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} glsaaqrqvvastwkdiagadngagvgkeclskfisahpemaavfgfsgasdpgvaelga kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg kmnaaakdawaaaygdisgalisglqs
Timeline for d1jf3a_: