Lineage for d1jezb_ (1jez B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081223Protein Xylose reductase [75058] (1 species)
  7. 2081224Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2081230Domain d1jezb_: 1jez B: [71641]

Details for d1jezb_

PDB Entry: 1jez (more details), 2.2 Å

PDB Description: the structure of xylose reductase, a dimeric aldo-keto reductase from candida tenuis
PDB Compounds: (B:) xylose reductase

SCOPe Domain Sequences for d1jezb_:

Sequence, based on SEQRES records: (download)

>d1jezb_ c.1.7.1 (B:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
pdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvkra
ideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvpie
ekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrgati
kpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahdti
kaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakldi
glrfndpwdwdnipifv

Sequence, based on observed residues (ATOM records): (download)

>d1jezb_ c.1.7.1 (B:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
pdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvkra
ideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvpie
ekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrgati
kpavlqvehhpylqqpkliefaqkagvtitayssflfahdtikaiaakynktpaevllrw
aaqrgiavipksnlperlvqnrsfntfdltkedfeeiakldiglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1jezb_:

Click to download the PDB-style file with coordinates for d1jezb_.
(The format of our PDB-style files is described here.)

Timeline for d1jezb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jeza_