Lineage for d1je6a2 (1je6 A:0-180)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600239Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 600243Species Human (Homo sapiens), Mic-b [TaxId:9606] [75380] (1 PDB entry)
  8. 600244Domain d1je6a2: 1je6 A:0-180 [71639]
    Other proteins in same PDB: d1je6a1
    complexed with so4

Details for d1je6a2

PDB Entry: 1je6 (more details), 2.5 Å

PDB Description: Structure of the MHC Class I Homolog MICB

SCOP Domain Sequences for d1je6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je6a2 d.19.1.1 (A:0-180) Class I MHC homolog {Human (Homo sapiens), Mic-b}
mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
r

SCOP Domain Coordinates for d1je6a2:

Click to download the PDB-style file with coordinates for d1je6a2.
(The format of our PDB-style files is described here.)

Timeline for d1je6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1je6a1