SCOP 1.73: Domain d1je6a1: 1je6 A:181-274

Lineage for d1je6a1 (1je6 A:181-274)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
   gamma, delta T-cell ligand

7. Species Human (Homo sapiens), Mic-b [TaxId:9606] [74826] (1 PDB entry)

8. Domain d1je6a1: 1je6 A:181-274 [71638]
   Other proteins in same PDB: d1je6a2
   complexed with so4

Details for d1je6a1

PDB Entry: 1je6, 2.5 Å

PDB Description: Structure of the MHC Class I Homolog MICB

PDB Compounds: (A:) MHC class I chain-related protein

SCOP Domain Sequences for d1je6a1:

Sequence; same for both SEQRES and ATOM records:

>d1je6a1 b.1.1.2 (A:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-b [TaxId: 9606]}
tvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgngt
yqtwvatrirqgeeqrftcymehsgnhgthpvps

Timeline for d1je6a1:

• d1je6a1 first appeared in SCOP 1.61
  
• d1je6a1 appears in SCOP 1.71
  
• d1je6a1 appears in SCOP 1.75
  
• d1je6a1 appears in the current release, SCOPe 2.07