Lineage for d1je6a1 (1je6 A:181-274)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 221963Protein MHC I homolog [48967] (3 species)
    gamma, delta T-cell ligand
  7. 221967Species Human (Homo sapiens), Micb [TaxId:9606] [74826] (1 PDB entry)
  8. 221968Domain d1je6a1: 1je6 A:181-274 [71638]
    Other proteins in same PDB: d1je6a2
    complexed with so4

Details for d1je6a1

PDB Entry: 1je6 (more details), 2.5 Å

PDB Description: structure of the mhc class i homolog micb

SCOP Domain Sequences for d1je6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je6a1 b.1.1.2 (A:181-274) MHC I homolog {Human (Homo sapiens), Micb}
tvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgngt
yqtwvatrirqgeeqrftcymehsgnhgthpvps

SCOP Domain Coordinates for d1je6a1:

Click to download the PDB-style file with coordinates for d1je6a1.
(The format of our PDB-style files is described here.)

Timeline for d1je6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1je6a2