Lineage for d1je6a1 (1je6 A:181-274)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein MHC I homolog [48967] (3 species) 
Species Human (Homo sapiens), Micb [TaxId:9606] [74826] (1 PDB entry) 
Domain d1je6a1: 1je6 A:181-274 [71638]
Other proteins in same PDB: d1je6a2
Details for d1je6a1
PDB Entry: 1je6 (more details), 2.5 Å
PDB Description: structure of the mhc class i homolog micb
SCOP Domain Sequences for d1je6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je6a1 b.1.1.2 (A:181-274) MHC I homolog {Human (Homo sapiens), Micb}
tvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgngt
yqtwvatrirqgeeqrftcymehsgnhgthpvps
SCOP Domain Coordinates for d1je6a1:
Click to download the PDB-style file with coordinates for d1je6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1je6a1:
- d1je6a1 is new in SCOP 1.61
- d1je6a1 appears in SCOP 1.63
- d1je6a1 appears in the current release, SCOPe 2.08
View in 3D
