SCOPe 2.07: Domain d1je3a1: 1je3 A:21-97

Lineage for d1je3a1 (1je3 A:21-97)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.3: SirA-like [64307] (1 family)

5. Family d.68.3.3: SirA-like [88852] (5 proteins)
   predicted redox protein, regulator of disulfide bond formation

6. Protein hypothetical protein YedF (EC005) [75475] (1 species)

7. Species Escherichia coli [TaxId:562] [75476] (1 PDB entry)

8. Domain d1je3a1: 1je3 A:21-97 [71637]
   Other proteins in same PDB: d1je3a2
   structural genomics

Details for d1je3a1

PDB Entry: 1je3

PDB Description: solution structure of ec005 from escherichia coli

PDB Compounds: (A:) hypothetical 8.6 kda protein in amya-flie intergenic region

SCOPe Domain Sequences for d1je3a1:

Sequence; same for both SEQRES and ATOM records:

>d1je3a1 d.68.3.3 (A:21-97) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]}
mknivpdyrldmvgepcpypavatleampqlkkgeilevvsdcpqsinnipldarnhgyt
vldiqqdgptiryliqk

Timeline for d1je3a1:

• d1je3a1 first appeared in SCOP 1.61, called d1je3a_
  
• d1je3a1 appears in SCOPe 2.06
  
• d1je3a1 appears in the current release, SCOPe 2.08