![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.3: SirA-like [64307] (1 family) ![]() |
![]() | Family d.68.3.3: SirA-like [88852] (4 proteins) predicted redox protein, regulator of disulfide bond formation |
![]() | Protein hypothetical protein YedF (EC005) [75475] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75476] (1 PDB entry) |
![]() | Domain d1je3a_: 1je3 A: [71637] structural genomics |
PDB Entry: 1je3 (more details)
SCOP Domain Sequences for d1je3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv sdcpqsinnipldarnhgytvldiqqdgptiryliqk
Timeline for d1je3a_: