| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species) |
| Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries) |
| Domain d1jdja2: 1jdj A:9-197 [71636] Other proteins in same PDB: d1jdja1 complexed with cfp, mys |
PDB Entry: 1jdj (more details), 2.2 Å
SCOP Domain Sequences for d1jdja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdja2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat
Timeline for d1jdja2: