SCOP 1.73: Domain d1jdja2: 1jdj A:9-197

Lineage for d1jdja2 (1jdj A:9-197)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries)

8. Domain d1jdja2: 1jdj A:9-197 [71636]
   Other proteins in same PDB: d1jdja1
   complexed with cfp, mys

Details for d1jdja2

PDB Entry: 1jdj, 2.2 Å

PDB Description: crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with 2-fluoro-6-chloropurine

PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOP Domain Sequences for d1jdja2:

Sequence; same for both SEQRES and ATOM records:

>d1jdja2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat

Timeline for d1jdja2:

• d1jdja2 first appeared in SCOP 1.61
  
• d1jdja2 appears in SCOP 1.71
  
• d1jdja2 appears in SCOP 1.75
  
• d1jdja2 appears in the current release, SCOPe 2.08