Lineage for d1jcia_ (1jci A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283714Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 283715Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 283716Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 283726Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 283727Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (80 PDB entries)
  8. 283744Domain d1jcia_: 1jci A: [71632]
    engineered calcium-binding loop
    complexed with hem, k; mutant

Details for d1jcia_

PDB Entry: 1jci (more details), 1.9 Å

PDB Description: stabilization of the engineered cation-binding loop in cytochrome c peroxidase (ccp)

SCOP Domain Sequences for d1jcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcia_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
hlknsgyegpwtanpnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1jcia_:

Click to download the PDB-style file with coordinates for d1jcia_.
(The format of our PDB-style files is described here.)

Timeline for d1jcia_: