SCOPe 2.07: Domain d1jbka1: 1jbk A:159-351

Lineage for d1jbka1 (1jbk A:159-351)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein ClpB, AAA+ modules [75211] (2 species)
   ATPase subunit of ATP-dependent protease; similar domain organization to ClpA

7. Species Escherichia coli [TaxId:562] [75212] (1 PDB entry)

8. Domain d1jbka1: 1jbk A:159-351 [71631]
   Other proteins in same PDB: d1jbka2
   N-terminal subdomain only
   complexed with mg

Details for d1jbka1

PDB Entry: 1jbk, 1.8 Å

PDB Description: Crystal Structure of the First Nucelotide Binding Domain of ClpB

PDB Compounds: (A:) clpb protein

SCOPe Domain Sequences for d1jbka1:

Sequence, based on SEQRES records:

>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}
qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg
laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid
elhtmvgagkadgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfv
aepsvedtiailr

Sequence, based on observed residues (ATOM records):

>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}
qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg
laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid
elhtmvgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfvaepsve
dtiailr

Timeline for d1jbka1:

• d1jbka1 first appeared in SCOP 1.61, called d1jbka_
  
• d1jbka1 appears in SCOPe 2.06
  
• d1jbka1 appears in the current release, SCOPe 2.08