Lineage for d1jbka1 (1jbk A:159-351)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479098Protein ClpB, AAA+ modules [75211] (2 species)
    ATPase subunit of ATP-dependent protease; similar domain organization to ClpA
  7. 2479099Species Escherichia coli [TaxId:562] [75212] (1 PDB entry)
  8. 2479100Domain d1jbka1: 1jbk A:159-351 [71631]
    Other proteins in same PDB: d1jbka2
    N-terminal subdomain only
    complexed with mg

Details for d1jbka1

PDB Entry: 1jbk (more details), 1.8 Å

PDB Description: Crystal Structure of the First Nucelotide Binding Domain of ClpB
PDB Compounds: (A:) clpb protein

SCOPe Domain Sequences for d1jbka1:

Sequence, based on SEQRES records: (download)

>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}
qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg
laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid
elhtmvgagkadgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfv
aepsvedtiailr

Sequence, based on observed residues (ATOM records): (download)

>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}
qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg
laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid
elhtmvgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfvaepsve
dtiailr

SCOPe Domain Coordinates for d1jbka1:

Click to download the PDB-style file with coordinates for d1jbka1.
(The format of our PDB-style files is described here.)

Timeline for d1jbka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbka2