Lineage for d1jbha_ (1jbh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805041Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species)
  7. 2805042Species Norway rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries)
  8. 2805051Domain d1jbha_: 1jbh A: [71630]

Details for d1jbha_

PDB Entry: 1jbh (more details)

PDB Description: solution structure of cellular retinol binding protein type-i in the ligand-free state
PDB Compounds: (A:) cellular retinol-binding protein type I

SCOPe Domain Sequences for d1jbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbha_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrn
yimdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlem
raegvtckqvfkkvh

SCOPe Domain Coordinates for d1jbha_:

Click to download the PDB-style file with coordinates for d1jbha_.
(The format of our PDB-style files is described here.)

Timeline for d1jbha_: