Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.2: NTF2-like [54431] (6 proteins) |
Protein Nuclear transport factor-2 (NTF2) [54432] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries) Uniprot P61972 |
Domain d1jb4b_: 1jb4 B: [71627] mutant |
PDB Entry: 1jb4 (more details), 2.23 Å
SCOPe Domain Sequences for d1jb4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb4b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]} kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqefllknindawvctndmfrlal hnf
Timeline for d1jb4b_: