SCOP 1.71: Domain d1jb2a_: 1jb2 A:

Lineage for d1jb2a_ (1jb2 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (12 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (5 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (10 PDB entries)

8. Domain d1jb2a_: 1jb2 A: [71624]

Details for d1jb2a_

PDB Entry: 1jb2, 2 Å

PDB Description: crystal structure of ntf2 m84e mutant

SCOP Domain Sequences for d1jb2a_:

Sequence; same for both SEQRES and ATOM records:

>d1jb2a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciisevvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnf

Timeline for d1jb2a_:

• d1jb2a_ first appeared in SCOP 1.61
  
• d1jb2a_ appears in SCOP 1.69
  
• d1jb2a_ appears in SCOP 1.73
  
• d1jb2a_ appears in the current release, SCOPe 2.08