Lineage for d1ja3b_ (1ja3 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738103Protein NK cell receptor [56452] (3 species)
  7. 738110Species Mouse (Mus musculus), ly49-i [TaxId:10090] [75582] (1 PDB entry)
  8. 738112Domain d1ja3b_: 1ja3 B: [71622]

Details for d1ja3b_

PDB Entry: 1ja3 (more details), 3 Å

PDB Description: Crystal Structure of the Murine NK Cell Inhibitory Receptor Ly-49I
PDB Compounds: (B:) MHC class I recognition receptor Ly49I

SCOP Domain Sequences for d1ja3b_:

Sequence, based on SEQRES records: (download)

>d1ja3b_ d.169.1.1 (B:) NK cell receptor {Mouse (Mus musculus), ly49-i [TaxId: 10090]}
vkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegywigl
sydkkkkewawidngpskfdmkirkmnfksrgcvflskariedtdcnipyycicgkkldk
f

Sequence, based on observed residues (ATOM records): (download)

>d1ja3b_ d.169.1.1 (B:) NK cell receptor {Mouse (Mus musculus), ly49-i [TaxId: 10090]}
vkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegywigl
sydkkkkewawidnkfdmkfksrgcvflskariedtdcnipyycicgkkldkf

SCOP Domain Coordinates for d1ja3b_:

Click to download the PDB-style file with coordinates for d1ja3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ja3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ja3a_