Lineage for d1j96a_ (1j96 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817598Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 1817599Species Human (Homo sapiens), type III [TaxId:9606] [69383] (14 PDB entries)
    bile acid binding protein
  8. 1817600Domain d1j96a_: 1j96 A: [71616]
    complexed with act, nap, tes

Details for d1j96a_

PDB Entry: 1j96 (more details), 1.25 Å

PDB Description: Human 3alpha-HSD type 3 in Ternary Complex with NADP and Testosterone
PDB Compounds: (A:) 3alpha-hydroxysteroid dehydrogenase type 3

SCOPe Domain Sequences for d1j96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j96a_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
rnvryltldifagppnypfsdey

SCOPe Domain Coordinates for d1j96a_:

Click to download the PDB-style file with coordinates for d1j96a_.
(The format of our PDB-style files is described here.)

Timeline for d1j96a_: