![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) |
![]() | Species Human (Homo sapiens), type III [TaxId:9606] [69383] (14 PDB entries) bile acid binding protein |
![]() | Domain d1j96a_: 1j96 A: [71616] complexed with act, nap, tes |
PDB Entry: 1j96 (more details), 1.25 Å
SCOPe Domain Sequences for d1j96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j96a_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]} ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln rnvryltldifagppnypfsdey
Timeline for d1j96a_: