Lineage for d1j96a_ (1j96 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173138Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 173139Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (8 proteins)
  6. 173144Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 173145Species Human (Homo sapiens), type III [TaxId:9606] [69383] (2 PDB entries)
  8. 173146Domain d1j96a_: 1j96 A: [71616]

Details for d1j96a_

PDB Entry: 1j96 (more details), 1.25 Å

PDB Description: Human 3alpha-HSD type 3 in Ternary Complex with NADP and Testosterone

SCOP Domain Sequences for d1j96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j96a_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III}
ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
rnvryltldifagppnypfsdey

SCOP Domain Coordinates for d1j96a_:

Click to download the PDB-style file with coordinates for d1j96a_.
(The format of our PDB-style files is described here.)

Timeline for d1j96a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j96b_