Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily) unusual fold |
Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) |
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins) |
Protein Phenylalanine hydroxylase, PAH [56538] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries) |
Domain d1j8ta_: 1j8t A: [71610] complexed with fe2 |
PDB Entry: 1j8t (more details), 1.7 Å
SCOP Domain Sequences for d1j8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ta_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)} vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy tqrievl
Timeline for d1j8ta_: