Lineage for d1j8ta_ (1j8t A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337435Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 337436Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 337437Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 337438Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 337443Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries)
  8. 337445Domain d1j8ta_: 1j8t A: [71610]
    complexed with fe2

Details for d1j8ta_

PDB Entry: 1j8t (more details), 1.7 Å

PDB Description: Catalytic Domain of Human Phenylalanine Hydroxylase Fe(II)

SCOP Domain Sequences for d1j8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ta_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv
eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc
tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr
sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc
lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy
tqrievl

SCOP Domain Coordinates for d1j8ta_:

Click to download the PDB-style file with coordinates for d1j8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ta_: