Lineage for d1j8he2 (1j8h E:119-246)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361087Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (30 PDB entries)
  8. 2361097Domain d1j8he2: 1j8h E:119-246 [71609]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1
    complexed with nag, ndg

Details for d1j8he2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1j8he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8he2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d1j8he2:

Click to download the PDB-style file with coordinates for d1j8he2.
(The format of our PDB-style files is described here.)

Timeline for d1j8he2: