Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries) |
Domain d1j8he2: 1j8h E:119-246 [71609] Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1 complexed with nag; mutant |
PDB Entry: 1j8h (more details), 2.4 Å
SCOP Domain Sequences for d1j8he2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8he2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain} dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d1j8he2: