SCOP 1.61: Domain d1j8he2: 1j8h E:119-246

Lineage for d1j8he2 (1j8h E:119-246)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (8 PDB entries)
Domain d1j8he2: 1j8h E:119-246 [71609]
Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1

Details for d1j8he2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8he2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOP Domain Coordinates for d1j8he2:

Click to download the PDB-style file with coordinates for d1j8he2.
(The format of our PDB-style files is described here.)

Timeline for d1j8he2: