Lineage for d1j8hd2 (1j8h D:118-203)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160265Protein T-cell antigen receptor [49125] (6 species)
  7. 160266Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (6 PDB entries)
  8. 160268Domain d1j8hd2: 1j8h D:118-203 [71607]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1

Details for d1j8hd2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA Antigen Peptide, and MHC Class II Molecule, HLA-DR4

SCOP Domain Sequences for d1j8hd2:

Sequence, based on SEQRES records: (download)

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf

SCOP Domain Coordinates for d1j8hd2:

Click to download the PDB-style file with coordinates for d1j8hd2.
(The format of our PDB-style files is described here.)

Timeline for d1j8hd2: