SCOP 1.71: Domain d1j8hd1: 1j8h D:1-117

Lineage for d1j8hd1 (1j8h D:1-117)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries)

8. Domain d1j8hd1: 1j8h D:1-117 [71606]
   Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd2, d1j8he2
   complexed with nag; mutant

Details for d1j8hd1

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8hd1:

Sequence; same for both SEQRES and ATOM records:

>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

Timeline for d1j8hd1:

• d1j8hd1 first appeared in SCOP 1.61
  
• d1j8hd1 appears in SCOP 1.69
  
• d1j8hd1 appears in SCOP 1.73
  
• d1j8hd1 appears in the current release, SCOPe 2.08