Lineage for d1j8hb2 (1j8h B:3-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501509Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (5 PDB entries)
  8. 501513Domain d1j8hb2: 1j8h B:3-92 [71605]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2

Details for d1j8hb2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8hb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1j8hb2:

Click to download the PDB-style file with coordinates for d1j8hb2.
(The format of our PDB-style files is described here.)

Timeline for d1j8hb2: