Lineage for d1j8hb1 (1j8h B:93-190)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933150Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 933158Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 933174Domain d1j8hb1: 1j8h B:93-190 [71604]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
    complexed with nag, ndg

Details for d1j8hb1

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-4 beta chain

SCOPe Domain Sequences for d1j8hb1:

Sequence, based on SEQRES records: (download)

>d1j8hb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1j8hb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1j8hb1:

Click to download the PDB-style file with coordinates for d1j8hb1.
(The format of our PDB-style files is described here.)

Timeline for d1j8hb1: