Lineage for d1j8ha2 (1j8h A:2-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897796Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1897859Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)
  8. 1897863Domain d1j8ha2: 1j8h A:2-81 [71603]
    Other proteins in same PDB: d1j8ha1, d1j8hb1, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
    complexed with nag, ndg

Details for d1j8ha2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1j8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ha2 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1j8ha2:

Click to download the PDB-style file with coordinates for d1j8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1j8ha2: