Lineage for d1j8ha1 (1j8h A:82-181)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933034Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 933042Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 933055Domain d1j8ha1: 1j8h A:82-181 [71602]
    Other proteins in same PDB: d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
    complexed with nag, ndg

Details for d1j8ha1

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1j8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ha1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d1j8ha1:

Click to download the PDB-style file with coordinates for d1j8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1j8ha1: