![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries) |
![]() | Domain d1j8ha1: 1j8h A:82-181 [71602] Other proteins in same PDB: d1j8ha2, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2 |
PDB Entry: 1j8h (more details), 2.4 Å
SCOP Domain Sequences for d1j8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ha1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1j8ha1: