SCOP 1.61: Domain d1j8ha1: 1j8h A:82-181

Lineage for d1j8ha1 (1j8h A:82-181)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries)

8. Domain d1j8ha1: 1j8h A:82-181 [71602]
   Other proteins in same PDB: d1j8ha2, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2

Details for d1j8ha1

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8ha1:

Sequence; same for both SEQRES and ATOM records:

>d1j8ha1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1j8ha1:

• d1j8ha1 is new in SCOP 1.61
  
• d1j8ha1 appears in SCOP 1.63
  
• d1j8ha1 appears in the current release, SCOPe 2.08