Lineage for d1j8ca_ (1j8c A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499587Protein Ubiquitin-like N-terminal domain of PLIC-2 [75358] (1 species)
  7. 499588Species Human (Homo sapiens) [TaxId:9606] [75359] (1 PDB entry)
  8. 499589Domain d1j8ca_: 1j8c A: [71601]

Details for d1j8ca_

PDB Entry: 1j8c (more details)

PDB Description: solution structure of the ubiquitin-like domain of hplic-2

SCOP Domain Sequences for d1j8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens)}
maengessgpprpsrgpaaaqgsaaapaepkiikvtvktpkekeefavpenssvqqfkea
iskrfksqtdqlvlifagkilkdqdtliqhgihdgltvhlvik

SCOP Domain Coordinates for d1j8ca_:

Click to download the PDB-style file with coordinates for d1j8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ca_: